PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013625518.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Trihelix
Protein Properties Length: 299aa    MW: 34059.1 Da    PI: 4.8927
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013625518.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix38.92.3e-121998180
        trihelix  1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcp 80
                    +Wt +  l L++    +e++ +++ +  ++W  +s+++ +  ++r+ +qC+ kw++l  +y +ik++e++++  ++s ++
  XP_013625518.1 19 EWTLKDCLILVNEIAAVESDCSNALSSFQKWTMISDNCNALDVHRTFNQCRRKWDSLVSDYSQIKKWESQERGSVHSYWS 98
                    5999*****************************************************************98766666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138378.6E-101999No hitNo description
PROSITE profilePS500906.3192076IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009506Cellular Componentplasmodesma
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MEEGTSSGSR RTRSQVAPEW TLKDCLILVN EIAAVESDCS NALSSFQKWT MISDNCNALD  60
VHRTFNQCRR KWDSLVSDYS QIKKWESQER GSVHSYWSLS VEKRRKLNLP GNVDNELFQA  120
INAVVMIQEN KDGSEPDSDS DPDAQEDFDV VDVTAELGSK RSRQRTMVVM KENPPHKRKT  180
EEEPRRKNIQ EQRAKATHQK KKTMEVKKKP VVEISTDEEE EEAMSIEEEV KALEAKLGEK  240
TDIIHAIVGR NLAKGSETED GVGIEDKLKF VRQQGDELIA CLSEIANTLD RLREVPQEI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1159164KRSRQR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013625518.10.0PREDICTED: uncharacterized protein LOC106331665 isoform X2
TrEMBLA0A078HF670.0A0A078HF67_BRANA; BnaC03g67720D protein
TrEMBLA0A0D3BM130.0A0A0D3BM13_BRAOL; Uncharacterized protein
STRINGBra010246.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31270.11e-110sequence-specific DNA binding transcription factors